HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide
For research use only. NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE.
Catalog Number: MPE0009315
Product Quantity: 5mg/20mg
Price: Varies
Availability: In Stock
Product Information
W7 and W32 are brominated. Active against Gram+ bacteria P. acnes ATCC 11827 and 33179, S. epidermidi, S. pyogenes, E. faecium, S. aureus ATCC 29213, C. perfringens ATCC 9081 and 13124, E. faecalis (MIC 2-32 uM); Gram- bacteria Bacteroides spp. ATCC 29771, 43935, and 12290, S. sonnei, S. maltophilia, Salmonella Group B, P. aeruginosa ATCC 27853, A. baumannii, E. coli ATCC 25922, E. aerogenes, E. cloacae, K. pneumoniae (MIC 0.5-16). HFIAP-2 is identical to HFIAP-1 in terms of amino acid sequence. However, HFIAP-2 is only brominated at residue W7. Updated 10/2014. HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) was found in Atlantic hagfish, Myxine glutinosa.
| Product Name: | HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide |
| Sequence: | GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR |
| Three letter code: | Gly-Phe-Phe-Lys-Lys-Ala-Trp-Arg-Lys-Val-Lys-His-Ala-Gly-Arg-Arg-Val-Leu-Asp-Thr-Ala-Lys-Gly-Val-Gly-Arg-His-Tyr-Val-Asn-Asn-Trp-Leu-Asn-Arg-Tyr-Arg |
| Length (aa): | 37 |
| Peptide Purity (HPLC): | >95%; 98% and 99% purity available upon request |
| Quantity/Unit: | 1 Vial |
| * Optional Service: | TFA Removal Service is available upon request. |
Technical Information
| Source: | Synthetic |
| Storage Guidelines: | Store at -20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides |
| Solubility: | Soluble in water |
| Appearance: | White to off-white powder |
| Shipping: | Peptides are shipped at ambient temperature by standard shipment process. |
| About TFA salt: | Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA. TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others. It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR. TFA Removal Service is recommended for: > Peptides that will be used in cellular assays > Peptides that will be used as APIs or in manufactured products > For hydrophilic peptides containing numerous basic residues |
Related Products / Services
Custom Peptide Synthesis: HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression. Read more...
Inquiry
{{config.bottom.content}}