FOXO4 D-Retro-Inverso(DRI) peptide (TFA Salt-free)
For research use only. NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE.
Catalog Number: MPE0005639
Product Quantity: 5mg/20mg
Price: Varies
Availability: In Stock
Product Information
Note: the Net Peptide Content(NPC) of current batch is 69.92%. Click to view moreFOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
| Product Name: | FOXO4 D-Retro-Inverso(DRI) peptide (TFA Salt-free) |
| Molecular Formula: | C228H388N86O64 |
| Molecular Weight: | 5358.05 |
| Sequence: | H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH |
| Three letter code: | H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH |
| Length (aa): | 51 |
| Peptide Purity (HPLC): | >95%; 98% and 99% purity available upon request |
| Quantity/Unit: | 1 Vial |
| * Optional Service: | TFA Removal Service is available upon request. |
Technical Information
| Source: | Synthetic |
| Storage Guidelines: | Store at -20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides |
| Solubility: | Soluble in water |
| Appearance: | White to off-white powder |
| Shipping: | Peptides are shipped at ambient temperature by standard shipment process. |
| About TFA salt: | Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA. TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others. It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR. TFA Removal Service is recommended for: > Peptides that will be used in cellular assays > Peptides that will be used as APIs or in manufactured products > For hydrophilic peptides containing numerous basic residues |
Related Products / Services
Custom Peptide Synthesis: FOXO4 D-Retro-Inverso(DRI) peptide (TFA Salt-free) peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression. Read more...
Inquiry
{{config.bottom.content}}