For research use only. NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE.
Catalog Number: MPE0006077
Product Quantity: 5mg/20mg
Price: Varies
Availability: In Stock
Esculentin-2PRa has Antibacterial, Antifungal activity. Esculentin-2PRa was found in North America,the Oregon spotted frog Rana pretiosa.
Product Name: | Esculentin-2PRa peptide |
Sequence: | GIFSALAAGVKLLGNTLFKMAGKAGAEHLACKATNQC |
Three letter code: | Gly-Ile-Phe-Ser-Ala-Leu-Ala-Ala-Gly-Val-Lys-Leu-Leu-Gly-Asn-Thr-Leu-Phe-Lys-Met-Ala-Gly-Lys-Ala-Gly-Ala-Glu-His-Leu-Ala-Cys-Lys-Ala-Thr-Asn-Gln-Cys |
Length (aa): | 37 |
Peptide Purity (HPLC): | >95%; 98% and 99% purity available upon request |
Quantity/Unit: | 1 Vial |
* Optional Service: | TFA Removal Service is available upon request. |
Source: | Synthetic |
Storage Guidelines: | Store at -20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides |
Solubility: | Soluble in water |
Appearance: | White to off-white powder |
Shipping: | Peptides are shipped at ambient temperature by standard shipment process. |
About TFA salt: | Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA. TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others. It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR. TFA Removal Service is recommended for: > Peptides that will be used in cellular assays > Peptides that will be used as APIs or in manufactured products > For hydrophilic peptides containing numerous basic residues |
Custom Peptide Synthesis: Esculentin-2PRa peptide peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression. Read more...
{{config.bottom.content}}