Beta-defensin 3 peptide
For research use only. NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE.
Catalog Number: MPE0007662
Product Quantity: 5mg/20mg
Price: Varies
Availability: In Stock
Product Information
This is a 5.1kDa 45-amino acid antimicrobial peptide called beta-Defensin-3 (hBD-3) having a beta sheet with three intramolecular disulfide bonds. It is expressed in high levels in keratinocytes and tonsilar tissue while expressed low in epithelia of the respiratory, gastrointestinal and genito-urinary tracts. Factors that induce its expression include TNF-alpha, IL-1beta and bacteria such as P. aeruginosa and S. aureus. hBD-3 is also potentially induced after exposure to IFN-gamma. In contrast to hBD-1, -2 and -4, hBD-3 demonstrates a salt-insensitive antimicrobial activity towards several pathogenic microorganisms at physiologic salt concentrations. This makes hBD-3 uniquely and particularly relevant in diseases where other hBDs show inactivity. The ability of hBD-3 to elicit its antimicrobial activity more effectively at the concentrations lower that those of hBD-1 and hBD-2 has been attributed to its amphipathic dimer structure and the increased positive surface charge (+9), compared to hBD-1 (+4) and hBD-2 (+6). hBD-3 has been shown to induce cytokine production from human keratinocytes and stimulates monocyte migration.
| Product Name: | Beta-defensin 3 peptide |
| Molecular Formula: | C216H371N75O59S6 |
| Molecular Weight: | 5155.09 |
| Sequence: | H-GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK-OH <br/>(Disulfide bridge: 11-40, 18-33, 23-41) |
| Three letter code: | H-Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys-OH |
| Length (aa): | 95 |
| Peptide Purity (HPLC): | >95%; 98% and 99% purity available upon request |
| Quantity/Unit: | 1 Vial |
| * Optional Service: | TFA Removal Service is available upon request. |
Technical Information
| Source: | Synthetic |
| Storage Guidelines: | Store at -20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides |
| Solubility: | Soluble in water |
| Appearance: | White to off-white powder |
| Shipping: | Peptides are shipped at ambient temperature by standard shipment process. |
| About TFA salt: | Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA. TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others. It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR. TFA Removal Service is recommended for: > Peptides that will be used in cellular assays > Peptides that will be used as APIs or in manufactured products > For hydrophilic peptides containing numerous basic residues |
Related Products / Services
Custom Peptide Synthesis: Beta-defensin 3 peptide peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression. Read more...
Inquiry
{{config.bottom.content}}