Abaecin peptide
For research use only. NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE.
Catalog Number: MPE0002206
Product Quantity: 5mg/20mg
Price: Varies
Availability: In Stock
Product Information
Rich in P. Active against A. tumefaciens Gembloux A, E. salicis NCPPB 2530, E. coli NCTC 9001 (MIC 25-50 ug/ml), E. coli NCTC 9001*, E. coli K514 (MIC 10-25 ug/ml), P. syringae pv. tomamta NCPPB 1105 (MIC 25-50 ug.ml), X. campestris pv. vesicatoria LMG 905 (MIC 5-10 ug/ml), and Gram-positive bacteria B. megaterium OMB 1551 (MIC 10-25 ug/ml) and M. luteus (M. lysodeikticus) LMG 4050 (MIC 10-25 ug/ml). Thus, the highest observed specific activity of the peptide was against an apidaecin-resistant Xanthomonas strain. Relish regulates expression of antimicrobial peptide genes in the honeybee, Apis mellifera, shown by RNA interference (Insect Mol Biol. 2007 Dec;16(6):753-9). APD Updated 10/2008. name corrected 5/2014 GW. Abaecin has Antibacterial activity. Abaecin was found in honeybee, Apis mellifera L..
| Product Name: | Abaecin peptide |
| Molecular Formula: | C187H270N48O43 |
| Molecular Weight: | 3878.4 |
| Sequence: | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
| Three letter code: | H-Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr-OH |
| Length (aa): | 34 |
| Peptide Purity (HPLC): | >95%; 98% and 99% purity available upon request |
| Quantity/Unit: | 1 Vial |
| * Optional Service: | TFA Removal Service is available upon request. |
Technical Information
| Source: | Synthetic |
| Storage Guidelines: | Store at -20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides |
| Solubility: | Soluble in water |
| Appearance: | White to off-white powder |
| Shipping: | Peptides are shipped at ambient temperature by standard shipment process. |
| About TFA salt: | Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA. TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others. It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR. TFA Removal Service is recommended for: > Peptides that will be used in cellular assays > Peptides that will be used as APIs or in manufactured products > For hydrophilic peptides containing numerous basic residues |
Related Products / Services
Custom Peptide Synthesis: Abaecin peptide peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression. Read more...
Inquiry
{{config.bottom.content}}